Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine LHB protein

This Bovine LHB protein spans the amino acid sequence from region 21-141aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LHB

UniProt

P04651

Expression Region

21-141aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 21-141aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SRGPLRPLCQPINATLAAEKEACPVCITFTTSICAGYCPSMKRVLPVILPPMPQRVCTYHELRFASVRLPGCPPGVDPMVSFPVALSCHCGPCRLSSTDCGGPRTQPLACDHPPLPDILFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBC1D24 Antibody
A71200-100UG 100 µg

TBC1D24 Antibody

Sign In for Pricing
View Details
GRK5 Colorimetric Cell-Based ELISA
EKC1709 1 Kit, containing one 96 Well Plate and all necessary reagents

GRK5 Colorimetric Cell-Based ELISA

Sign In for Pricing
View Details
PISD, ID (Phosphatidylserine Decarboxylase Proenzyme, Phosphatidylserine Decarboxylase alpha Chain, Phosphatidylserine Decarboxylase beta Chain) (Azide free) (HRP) discontinued
P4207-30-HRP 200 µL

PISD, ID (Phosphatidylserine Decarboxylase Proenzyme, Phosphatidylserine Decarboxylase alpha Chain, Phosphatidylserine Decarboxylase beta Chain) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
3- (Furan-2-yl) but-2-enoic acid
SEA61263-01 100 mg

3- (Furan-2-yl) but-2-enoic acid

Sign In for Pricing
View Details
3- (Furan-2-yl) but-2-enoic acid
SEA61263-02 1 g

3- (Furan-2-yl) but-2-enoic acid

Sign In for Pricing
View Details
TPX2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
47421154 3x 1.0 µg DNA

TPX2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details