Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KITLG protein

This Human KITLG protein spans the amino acid sequence from region 26-189aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

KITLG

UniProt

P21583

Expression Region

26-189aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of Soluble KIT ligand chain of GST-tag and expression region is 26-189aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DTNBP1 Rabbit Polyclonal Antibody (APC)
orb1005553 100 µL

DTNBP1 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Recombinant Pseudoalteromonas haloplanktis GTP cyclohydrolase folE2 (folE2)
MBS1287552-01 0.02 mg (E-Coli)

Recombinant Pseudoalteromonas haloplanktis GTP cyclohydrolase folE2 (folE2)

Sign In for Pricing
View Details
Recombinant Pseudoalteromonas haloplanktis GTP cyclohydrolase folE2 (folE2)
MBS1287552-02 0.02 mg (Yeast)

Recombinant Pseudoalteromonas haloplanktis GTP cyclohydrolase folE2 (folE2)

Sign In for Pricing
View Details
Recombinant Pseudoalteromonas haloplanktis GTP cyclohydrolase folE2 (folE2)
MBS1287552-03 0.1 mg (E-Coli)

Recombinant Pseudoalteromonas haloplanktis GTP cyclohydrolase folE2 (folE2)

Sign In for Pricing
View Details
Recombinant Pseudoalteromonas haloplanktis GTP cyclohydrolase folE2 (folE2)
MBS1287552-04 0.1 mg (Yeast)

Recombinant Pseudoalteromonas haloplanktis GTP cyclohydrolase folE2 (folE2)

Sign In for Pricing
View Details
Recombinant Pseudoalteromonas haloplanktis GTP cyclohydrolase folE2 (folE2)
MBS1287552-05 0.02 mg (Baculovirus)

Recombinant Pseudoalteromonas haloplanktis GTP cyclohydrolase folE2 (folE2)

Sign In for Pricing
View Details