Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KIAA0101 protein

This Human KIAA0101 protein spans the amino acid sequence from region 1-111aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

KIAA0101

UniProt

Q15004

Expression Region

1-111aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of GST-tag and expression region is 1-111aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITPKA (NM_002220) Human Recombinant Protein
TP305323L 1 mg

ITPKA (NM_002220) Human Recombinant Protein

Sign In for Pricing
View Details
Fluorescein dicaprylate [Fluorescein dioctanoate]
22019-AAT 100 mg

Fluorescein dicaprylate [Fluorescein dioctanoate]

Sign In for Pricing
View Details
Sf3b4 Mouse Gene Knockout Kit (CRISPR)
KN515645 1 Kit

Sf3b4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Renal Cell Carcinoma (Carbonic Anhydrase IX) (CA9/2993R), 0.2mg/mL
BNUB2993-500 1x 500 µL

Renal Cell Carcinoma (Carbonic Anhydrase IX) (CA9/2993R), 0.2mg/mL

Sign In for Pricing
View Details
IRAK4 (N-term) Rabbit Polyclonal Antibody
AP52231PU-N 400 µL

IRAK4 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS808784 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details