Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KIAA0101 protein

This Human KIAA0101 protein spans the amino acid sequence from region 1-111aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

KIAA0101

UniProt

Q15004

Expression Region

1-111aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of GST-tag and expression region is 1-111aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 6 (MUC6) (CLH5), 1mg/mL
BNUM0891-50 1x 50 µL

Mucin 6 (MUC6) (CLH5), 1mg/mL

Sign In for Pricing
View Details
EED (NM_003797) Human Over-expression Lysate
LY401248 100 µg

EED (NM_003797) Human Over-expression Lysate

Sign In for Pricing
View Details
CYP4A11 Recombinant Rabbit Monoclonal Antibody [JE40-81]
HA722348 100 µL

CYP4A11 Recombinant Rabbit Monoclonal Antibody [JE40-81]

Sign In for Pricing
View Details
KLF5 (NM_001730) Human Over-expression Lysate
LC419775 20 µg

KLF5 (NM_001730) Human Over-expression Lysate

Sign In for Pricing
View Details
Human VCX3B activation kit by CRISPRa
GA118419 1 Kit

Human VCX3B activation kit by CRISPRa

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF647 conjugate, 0.1mg/mL
BNC470679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details