Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Irf8 protein

This Mouse Irf8 protein spans the amino acid sequence from region 1-424aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Irf8

UniProt

P23611

Expression Region

1-424aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-424aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MCDRNGGRRLRQWLIEQIDSSMYPGLIWENDEKTMFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEGDKAEPATWKTRLRCALNKSPDFEEVTDRSQLDISEPYKVYRIVPEEEQKCKLGVAPAGCMSEVPEMECGRSEIEELIKEPSVDEYMGMTKRSPSPPEACRSQILPDWWVQQPSAGLPLVTGYAAYDTHHSAFSQMVISFYYGGKLVGQATTTCLEGCRLSLSQPGLPKLYGPDGLEPVCFPTADTIPSERQRQVTRKLFGHLERGVLLHSNRKGVFVKRLCQGRVFCSGNAVVCKGRPNKLERDEVVQVFDTNQFIRELQQFYATQSRLPDSRVVLCFGEEFPDTVPLRSKLILVQVEQLYARQLVEEAGKSCGAGSLMPALEEPQPDQAFRMFPDICTSHQRPFFRENQQITV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRTAP2-4 (NM_033184) Human Tagged Lenti ORF Clone
RC215356L1 10 µg

KRTAP2-4 (NM_033184) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ACTA2 Antibody
orb757213 100 µL

ACTA2 Antibody

Sign In for Pricing
View Details
Anti-Eif1  (2E1)
YF-MA17182 200 ul

Anti-Eif1 (2E1)

Sign In for Pricing
View Details
Porcine Pyruvate Dehydrogenase Phosphatase PDP ELISA Kit
BG-POR11787 1 Each

Porcine Pyruvate Dehydrogenase Phosphatase PDP ELISA Kit

Sign In for Pricing
View Details
CD61 (ITGB3, Integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61), GP3A, GPIIIa, Integrin beta-3, Platelet membrane glycoprotein IIIa) (Biotin) discontinued
C2414-16-Biotin 100 µL

CD61 (ITGB3, Integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61), GP3A, GPIIIa, Integrin beta-3, Platelet membrane glycoprotein IIIa) (Biotin) discontinued

Sign In for Pricing
View Details
Anti-Human IgM (u chain) Antibody F (ab) '2 - TRITC Conjugated
OAIB00371-500UG 0.5 mg

Anti-Human IgM (u chain) Antibody F (ab) '2 - TRITC Conjugated

Sign In for Pricing
View Details