Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Irf8 protein

This Mouse Irf8 protein spans the amino acid sequence from region 1-424aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Irf8

UniProt

P23611

Expression Region

1-424aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-424aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MCDRNGGRRLRQWLIEQIDSSMYPGLIWENDEKTMFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEGDKAEPATWKTRLRCALNKSPDFEEVTDRSQLDISEPYKVYRIVPEEEQKCKLGVAPAGCMSEVPEMECGRSEIEELIKEPSVDEYMGMTKRSPSPPEACRSQILPDWWVQQPSAGLPLVTGYAAYDTHHSAFSQMVISFYYGGKLVGQATTTCLEGCRLSLSQPGLPKLYGPDGLEPVCFPTADTIPSERQRQVTRKLFGHLERGVLLHSNRKGVFVKRLCQGRVFCSGNAVVCKGRPNKLERDEVVQVFDTNQFIRELQQFYATQSRLPDSRVVLCFGEEFPDTVPLRSKLILVQVEQLYARQLVEEAGKSCGAGSLMPALEEPQPDQAFRMFPDICTSHQRPFFRENQQITV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APOBR siRNA (Mouse)
MBS828340-01 15 nmol

APOBR siRNA (Mouse)

Sign In for Pricing
View Details
APOBR siRNA (Mouse)
MBS828340-02 30 nmol

APOBR siRNA (Mouse)

Sign In for Pricing
View Details
APOBR siRNA (Mouse)
MBS828340-03 5x 30 nmol

APOBR siRNA (Mouse)

Sign In for Pricing
View Details
Human Protein Inhibitor Of Activated STAT 3 (PIAS3) ELISA Kit
EKU06907 96 Tests

Human Protein Inhibitor Of Activated STAT 3 (PIAS3) ELISA Kit

Sign In for Pricing
View Details
Negative EZ Cap™ EGFP mRNA (5-moUTP)
R1031-.1 100 µg (1 mg/mL)

Negative EZ Cap™ EGFP mRNA (5-moUTP)

Sign In for Pricing
View Details
PROKR1 Antibody
OAAJ06026-100UL 100 µL

PROKR1 Antibody

Sign In for Pricing
View Details