Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Irf5 protein

This Mouse Irf5 protein spans the amino acid sequence from region 1-497aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Irf5

UniProt

P56477

Expression Region

1-497aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

72 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-497aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNHSAPGIPPPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFYIPWRHATRHGPSQDGDNTIFKAWAKETGKYTEGVDEADPAKWKANLRCALNKSRDFQLFYDGPRDMPPQPYKIYEVCSNGPAPTESQPTDDYVLGEEEEEEEEELQRMLPGLSITEPALPGPPNAPYSLPKEDTKWPPALQPPVGLGPPVPDPNLLAPPSGNPAGFRQLLPEVLEPGPLASSQPPTEPLLPDLLISPHMLPLTDLEIKFQYRGRAPRTLTISNPQGCRLFYSQLEATQEQVELFGPVTLEQVRFPSPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPCALAHGSCPNPIQREVKTKLFSLEQFLNELILFQKGQTNTPPPFEIFFCFGEEWPDVKPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQISNPDLKDHMVEQFKELHHLWQSQQQLQPMVQAPPVAGLDASQGPWPMHPVGMQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPT1P8 Antibody
orb686596-01 50 μL

TPT1P8 Antibody

Sign In for Pricing
View Details
TPT1P8 Antibody
orb686596-02 100 µL

TPT1P8 Antibody

Sign In for Pricing
View Details
Hsa-miR-7109-5p miRNA Antagomir
CIJ2461-01 10 nmol

Hsa-miR-7109-5p miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-7109-5p miRNA Antagomir
CIJ2461-02 20 nmol

Hsa-miR-7109-5p miRNA Antagomir

Sign In for Pricing
View Details
PMG36e-P32-EGFP Plasmid
PVT69690 2 µg

PMG36e-P32-EGFP Plasmid

Sign In for Pricing
View Details
Agap1-set siRNA/shRNA/RNAi Lentivector (Mouse)
11492094 4x 500 ng

Agap1-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details