Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL3 protein

This Human IL3 protein spans the amino acid sequence from region 20-152aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL3

UniProt

P08700

Expression Region

20-152aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of GST-tag and expression region is 20-152aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat T-complex protein 1 subunit beta (Cct2)
MBS1423223-01 0.02 mg (E-Coli)

Recombinant Rat T-complex protein 1 subunit beta (Cct2)

Sign In for Pricing
View Details
Recombinant Rat T-complex protein 1 subunit beta (Cct2)
MBS1423223-02 0.02 mg (Yeast)

Recombinant Rat T-complex protein 1 subunit beta (Cct2)

Sign In for Pricing
View Details
Recombinant Rat T-complex protein 1 subunit beta (Cct2)
MBS1423223-03 0.1 mg (E-Coli)

Recombinant Rat T-complex protein 1 subunit beta (Cct2)

Sign In for Pricing
View Details
Recombinant Rat T-complex protein 1 subunit beta (Cct2)
MBS1423223-04 0.1 mg (Yeast)

Recombinant Rat T-complex protein 1 subunit beta (Cct2)

Sign In for Pricing
View Details
Recombinant Rat T-complex protein 1 subunit beta (Cct2)
MBS1423223-05 0.02 mg (Baculovirus)

Recombinant Rat T-complex protein 1 subunit beta (Cct2)

Sign In for Pricing
View Details
Recombinant Rat T-complex protein 1 subunit beta (Cct2)
MBS1423223-06 0.02 mg (Mammalian-Cell)

Recombinant Rat T-complex protein 1 subunit beta (Cct2)

Sign In for Pricing
View Details