Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GSTA4 protein

This Human GSTA4 protein spans the amino acid sequence from region 1-222aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GSTA4

UniProt

O15217

Expression Region

1-222aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-222aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Synechococcus sp. Cell division topological specificity factor (minE)
MBS1050811-01 0.02 mg (E-Coli)

Recombinant Synechococcus sp. Cell division topological specificity factor (minE)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Cell division topological specificity factor (minE)
MBS1050811-02 0.1 mg (E-Coli)

Recombinant Synechococcus sp. Cell division topological specificity factor (minE)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Cell division topological specificity factor (minE)
MBS1050811-03 0.02 mg (Yeast)

Recombinant Synechococcus sp. Cell division topological specificity factor (minE)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Cell division topological specificity factor (minE)
MBS1050811-04 0.1 mg (Yeast)

Recombinant Synechococcus sp. Cell division topological specificity factor (minE)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Cell division topological specificity factor (minE)
MBS1050811-05 0.02 mg (Baculovirus)

Recombinant Synechococcus sp. Cell division topological specificity factor (minE)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Cell division topological specificity factor (minE)
MBS1050811-06 1 mg (E-Coli)

Recombinant Synechococcus sp. Cell division topological specificity factor (minE)

Sign In for Pricing
View Details