Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CEACAM4 protein

This Human CEACAM4 protein spans the amino acid sequence from region 36-155aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CEACAM4

UniProt

O75871

Expression Region

36-155aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHVHQNNVPGLPVGAVAG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Synapsin II (SYN2) ELISA Kit
EKN52562-01 48 Tests

Rat Synapsin II (SYN2) ELISA Kit

Sign In for Pricing
View Details
Rat Synapsin II (SYN2) ELISA Kit
EKN52562-02 96 Tests

Rat Synapsin II (SYN2) ELISA Kit

Sign In for Pricing
View Details
Rat Synapsin II (SYN2) ELISA Kit
EKN52562-03 5x 96 Tests

Rat Synapsin II (SYN2) ELISA Kit

Sign In for Pricing
View Details
Phospho-CHEK2 (Thr68) Recombinant Antibody, APC Conjugated
bsm-61583R-APC-01 20 µL

Phospho-CHEK2 (Thr68) Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details
Phospho-CHEK2 (Thr68) Recombinant Antibody, APC Conjugated
bsm-61583R-APC-02 100 µL

Phospho-CHEK2 (Thr68) Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details
Cadherin-5 (CDH5) Antibody
abx455176-01 50 µg

Cadherin-5 (CDH5) Antibody

Sign In for Pricing
View Details