Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CD70 protein

This Human CD70 protein spans the amino acid sequence from region 39-193. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD70

UniProt

P32970

Expression Region

39-193

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

10X TAE buffer solution
A00239 500ml

10X TAE buffer solution

Sign In for Pricing
View Details
Human Transforming growth factor-beta-induced protein ig-h3 (TGFBI) ELISA Kit
AE17201HU-01 48 Tests

Human Transforming growth factor-beta-induced protein ig-h3 (TGFBI) ELISA Kit

Sign In for Pricing
View Details
Human Transforming growth factor-beta-induced protein ig-h3 (TGFBI) ELISA Kit
AE17201HU-02 96 Tests

Human Transforming growth factor-beta-induced protein ig-h3 (TGFBI) ELISA Kit

Sign In for Pricing
View Details
Ig lambda-2 chain C regions (IGLC2) Human ELISA Kit
E1750 96 Tests

Ig lambda-2 chain C regions (IGLC2) Human ELISA Kit

Sign In for Pricing
View Details
3-Bromo-8- (trifluoromethoxy) quinoline
PC1001820-01 100 mg

3-Bromo-8- (trifluoromethoxy) quinoline

Sign In for Pricing
View Details
3-Bromo-8- (trifluoromethoxy) quinoline
PC1001820-02 250 mg

3-Bromo-8- (trifluoromethoxy) quinoline

Sign In for Pricing
View Details