Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CD70 protein

This Human CD70 protein spans the amino acid sequence from region 39-193. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD70

UniProt

P32970

Expression Region

39-193

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Galactosidase Beta (GLb)
TRV-0007406-01 10 µg

Recombinant Galactosidase Beta (GLb)

Sign In for Pricing
View Details
Recombinant Galactosidase Beta (GLb)
TRV-0007406-02 50 µg

Recombinant Galactosidase Beta (GLb)

Sign In for Pricing
View Details
Recombinant Galactosidase Beta (GLb)
TRV-0007406-03 100 µg

Recombinant Galactosidase Beta (GLb)

Sign In for Pricing
View Details
Recombinant Galactosidase Beta (GLb)
TRV-0007406-04 200 µg

Recombinant Galactosidase Beta (GLb)

Sign In for Pricing
View Details
Recombinant Galactosidase Beta (GLb)
TRV-0007406-05 500 µg

Recombinant Galactosidase Beta (GLb)

Sign In for Pricing
View Details
Recombinant Galactosidase Beta (GLb)
TRV-0007406-06 1 mg

Recombinant Galactosidase Beta (GLb)

Sign In for Pricing
View Details