Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sheep GHRH protein

This Sheep GHRH protein spans the amino acid sequence from region 1-44aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GHRH

UniProt

P07217

Expression Region

1-44aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Ovis aries (Sheep)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of GST-tag and expression region is 1-44aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Simian CYP2E1 (Cytochrome P450 2E1) ELISA Kit
orb3126969-01 48 Tests

Simian CYP2E1 (Cytochrome P450 2E1) ELISA Kit

Sign In for Pricing
View Details
Simian CYP2E1 (Cytochrome P450 2E1) ELISA Kit
orb3126969-02 96 Tests

Simian CYP2E1 (Cytochrome P450 2E1) ELISA Kit

Sign In for Pricing
View Details
Anti-Ugt1a1 Antibody Picoband®, Dylight594 Conjugate
A01865-2-Dylight594 100 µg

Anti-Ugt1a1 Antibody Picoband®, Dylight594 Conjugate

Sign In for Pricing
View Details
Immunol Fluorescence Staining Kit (Anti-Mouse IgG-FITC)
MBS2567153-01 50 Assays

Immunol Fluorescence Staining Kit (Anti-Mouse IgG-FITC)

Sign In for Pricing
View Details
Immunol Fluorescence Staining Kit (Anti-Mouse IgG-FITC)
MBS2567153-02 100 Assays

Immunol Fluorescence Staining Kit (Anti-Mouse IgG-FITC)

Sign In for Pricing
View Details
Immunol Fluorescence Staining Kit (Anti-Mouse IgG-FITC)
MBS2567153-03 200 Assays

Immunol Fluorescence Staining Kit (Anti-Mouse IgG-FITC)

Sign In for Pricing
View Details