Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sheep GHRH protein

This Sheep GHRH protein spans the amino acid sequence from region 1-44aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GHRH

UniProt

P07217

Expression Region

1-44aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Ovis aries (Sheep)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of GST-tag and expression region is 1-44aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YnfB Antibody
orb829869 2 mg

YnfB Antibody

Sign In for Pricing
View Details
EXDL1 Antibody
orb1323946 100 µL

EXDL1 Antibody

Sign In for Pricing
View Details
5′ 6-FAM / 3′ DABCYL (5 to 9 nmol)
JBS-FP-183-05 5 nmol

5′ 6-FAM / 3′ DABCYL (5 to 9 nmol)

Sign In for Pricing
View Details
Vonoprazan Impurity 194
RM-V141794-01 10 mg

Vonoprazan Impurity 194

Sign In for Pricing
View Details
Vonoprazan Impurity 194
RM-V141794-02 25 mg

Vonoprazan Impurity 194

Sign In for Pricing
View Details
Vonoprazan Impurity 194
RM-V141794-03 50 mg

Vonoprazan Impurity 194

Sign In for Pricing
View Details