Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CD7 protein

This Human CD7 protein spans the amino acid sequence from region 26-180aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD7

UniProt

P09564

Expression Region

26-180aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AdmiRa-mmu-miR-302d-5p-Off Virus
mm5449 1.0 mL

AdmiRa-mmu-miR-302d-5p-Off Virus

Sign In for Pricing
View Details
GluR1, phosphorylated (Ser845) (Glutamate Receptor) (MaxLight 405) discontinued
G3500-05A-ML405 100 µL

GluR1, phosphorylated (Ser845) (Glutamate Receptor) (MaxLight 405) discontinued

Sign In for Pricing
View Details
PNMA1 (Paraneoplastic Antigen MA1, MA1) (AP) discontinued
250261-AP 100 µL

PNMA1 (Paraneoplastic Antigen MA1, MA1) (AP) discontinued

Sign In for Pricing
View Details
Cd209a 3'UTR GFP Stable Cell Line
TU251947 1.0 mL

Cd209a 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rho GTPase-activating protein 36, CT (ARHGAP36, RP13-102H20.1) (PE)
MBS6341916-01 0.2 mL

Rho GTPase-activating protein 36, CT (ARHGAP36, RP13-102H20.1) (PE)

Sign In for Pricing
View Details
Rho GTPase-activating protein 36, CT (ARHGAP36, RP13-102H20.1) (PE)
MBS6341916-02 5x 0.2 mL

Rho GTPase-activating protein 36, CT (ARHGAP36, RP13-102H20.1) (PE)

Sign In for Pricing
View Details