Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GAGE5 protein

This Human GAGE5 protein spans the amino acid sequence from region 1-117aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GAGE5

UniProt

Q13069

Expression Region

1-117aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of GST-tag and expression region is 1-117aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSWRGRSTYYWPRPRRYVQPPEVIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Basigin (BSG) Antibody
abx270221-01 50 Tests

Basigin (BSG) Antibody

Sign In for Pricing
View Details
Basigin (BSG) Antibody
abx270221-02 100 Tests

Basigin (BSG) Antibody

Sign In for Pricing
View Details
Basigin (BSG) Antibody
abx270221-03 200 Tests

Basigin (BSG) Antibody

Sign In for Pricing
View Details
Basigin (BSG) Antibody
abx270221-04 500 Tests

Basigin (BSG) Antibody

Sign In for Pricing
View Details
LOC690344 Recombinant Protein (Rat)
RP209648 100 µg

LOC690344 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Mouse Slc39a9 (NM_026244) AAV Particle
MR216954A1V 250 µL

Mouse Slc39a9 (NM_026244) AAV Particle

Sign In for Pricing
View Details