Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GADD45G protein

This Human GADD45G protein spans the amino acid sequence from region 1-159aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GADD45G

UniProt

O95257

Expression Region

1-159aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-159aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Helicobacter Pylori rplO Protein (aa 1-133)
VAng-Lsx3355-50gEcoli 50 µg (E. coli)

Recombinant Helicobacter Pylori rplO Protein (aa 1-133)

Sign In for Pricing
View Details
Phospho-FGFR2 Antibody BIOTIN-Conjugated
MBS543684-01 0.1 mg

Phospho-FGFR2 Antibody BIOTIN-Conjugated

Sign In for Pricing
View Details
Phospho-FGFR2 Antibody BIOTIN-Conjugated
MBS543684-02 5x 0.1 mg

Phospho-FGFR2 Antibody BIOTIN-Conjugated

Sign In for Pricing
View Details
MCT12 Lentiviral Activation Particles (m2)
sc-433777-LAC-2 200 µL

MCT12 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
MICB (NM_005931) Human Tagged ORF Clone Lentiviral Particle
RC222315L2V 200 µL

MICB (NM_005931) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rabbit Anti Human GRIN2C Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (IHC,ELISA) 200UL
IRBAHUGRIN2CAP00200UL 200 µL

Rabbit Anti Human GRIN2C Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (IHC,ELISA) 200UL

Sign In for Pricing
View Details