Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GABRA4 protein

This Human GABRA4 protein spans the amino acid sequence from region 36-258aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GABRA4

UniProt

P48169

Expression Region

36-258aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Extracellular of His-SUMO-tag and expression region is 36-258aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QNQKEEKLCTENFTRILDSLLDGYDNRLRPGFGGPVTEVKTDIYVTSFGPVSDVEMEYTMDVFFRQTWIDKRLKYDGPIEILRLNNMMVTKVWTPDTFFRNGKKSVSHNMTAPNKLFRIMRNGTILYTMRLTISAECPMRLVDFPMDGHACPLKFGSYAYPKSEMIYTWTKGPEKSVEVPKESSSLVQYDLIGQTVSSETIKSITGEYIVMTVYFHLRRKMGY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pig Transforming growth factor alpha (TGFalpha) ELISA Kit
MBS2804550-01 48 Tests

Pig Transforming growth factor alpha (TGFalpha) ELISA Kit

Sign In for Pricing
View Details
Pig Transforming growth factor alpha (TGFalpha) ELISA Kit
MBS2804550-02 96 Tests

Pig Transforming growth factor alpha (TGFalpha) ELISA Kit

Sign In for Pricing
View Details
Pig Transforming growth factor alpha (TGFalpha) ELISA Kit
MBS2804550-03 5x 96 Tests

Pig Transforming growth factor alpha (TGFalpha) ELISA Kit

Sign In for Pricing
View Details
Pig Transforming growth factor alpha (TGFalpha) ELISA Kit
MBS2804550-04 10x 96 Tests

Pig Transforming growth factor alpha (TGFalpha) ELISA Kit

Sign In for Pricing
View Details
Connexin 32/GJB1 Rabbit Polyclonal Antibody (Biotin)
orb2579246 100 µg

Connexin 32/GJB1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
2-Acetamido-2-deoxy-4-O- (β-D-galactopyranosyl) -D-galactopyranose
001089 5 mg

2-Acetamido-2-deoxy-4-O- (β-D-galactopyranosyl) -D-galactopyranose

Sign In for Pricing
View Details