Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CCL8 protein

This Human CCL8 protein spans the amino acid sequence from region 24-99aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CCL8

UniProt

P80075

Expression Region

24-99aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPTN Antibody
orb1322028-01 30 µL

NPTN Antibody

Sign In for Pricing
View Details
NPTN Antibody
orb1322028-02 50 μL

NPTN Antibody

Sign In for Pricing
View Details
NPTN Antibody
orb1322028-03 100 µL

NPTN Antibody

Sign In for Pricing
View Details
Recombinant Human FBN2 Protein, N-GST
orb3061842-01 50 µg

Recombinant Human FBN2 Protein, N-GST

Sign In for Pricing
View Details
Recombinant Human FBN2 Protein, N-GST
orb3061842-02 100 µg

Recombinant Human FBN2 Protein, N-GST

Sign In for Pricing
View Details
Recombinant Human FBN2 Protein, N-GST
orb3061842-03 1 mg

Recombinant Human FBN2 Protein, N-GST

Sign In for Pricing
View Details