Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Fgf21 protein

This Mouse Fgf21 protein spans the amino acid sequence from region 29-210aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fgf21

UniProt

Q9JJN1

Expression Region

29-210aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 29-210aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAM-16
BA1423-25 25 mg

TAM-16

Sign In for Pricing
View Details
Caspase-12 Rabbit Polyclonal Antibody (BF750)
orb2548053 100 µL

Caspase-12 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Recombinant Labeo rohita Translationally-controlled tumor protein homolog (tpt1)
MBS1437236-01 0.05 mg (E-Coli)

Recombinant Labeo rohita Translationally-controlled tumor protein homolog (tpt1)

Sign In for Pricing
View Details
Recombinant Labeo rohita Translationally-controlled tumor protein homolog (tpt1)
MBS1437236-02 0.05 mg (Yeast)

Recombinant Labeo rohita Translationally-controlled tumor protein homolog (tpt1)

Sign In for Pricing
View Details
Recombinant Labeo rohita Translationally-controlled tumor protein homolog (tpt1)
MBS1437236-03 0.2 mg (E-Coli)

Recombinant Labeo rohita Translationally-controlled tumor protein homolog (tpt1)

Sign In for Pricing
View Details
Recombinant Labeo rohita Translationally-controlled tumor protein homolog (tpt1)
MBS1437236-04 0.5 mg (E-Coli)

Recombinant Labeo rohita Translationally-controlled tumor protein homolog (tpt1)

Sign In for Pricing
View Details