Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CBX7 protein

This Human CBX7 protein spans the amino acid sequence from region 1-251aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CBX7

UniProt

O95931

Expression Region

1-251aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PBK Human Pre-designed siRNA Set A
HY-RS10101 1 Set

PBK Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
GH1 Blocking Peptide
MBS9620523-01 1 mg

GH1 Blocking Peptide

Sign In for Pricing
View Details
GH1 Blocking Peptide
MBS9620523-02 5x 1 mg

GH1 Blocking Peptide

Sign In for Pricing
View Details
Goat Olfactory receptor 52N4 (OR52N4) ELISA kit
GTR10410299 96 Well

Goat Olfactory receptor 52N4 (OR52N4) ELISA kit

Sign In for Pricing
View Details
Clarithromycin 100mg
A10225-100 100 mg

Clarithromycin 100mg

Sign In for Pricing
View Details
PCDHB15 (NM_018935) Human Tagged Lenti ORF Clone
RC207719L1 10 µg

PCDHB15 (NM_018935) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details