Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CBX7 protein

This Human CBX7 protein spans the amino acid sequence from region 1-251aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CBX7

UniProt

O95931

Expression Region

1-251aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat MMP-3(Matrix Metalloproteinase 3) ELISA Kit
SYP-R0175-01 48 Well

Rat MMP-3(Matrix Metalloproteinase 3) ELISA Kit

Sign In for Pricing
View Details
Rat MMP-3(Matrix Metalloproteinase 3) ELISA Kit
SYP-R0175-02 96 Well

Rat MMP-3(Matrix Metalloproteinase 3) ELISA Kit

Sign In for Pricing
View Details
Human SLITRK6 ELISA Kit PicoKine®, Carrier-free
EK1868-carrier-free 96 Well With Removable Strips

Human SLITRK6 ELISA Kit PicoKine®, Carrier-free

Sign In for Pricing
View Details
AVPR1B Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-11800R-BF555 100 µL

AVPR1B Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Recombinant Human SDHAF2 Protein
E30P1812 20 µg

Recombinant Human SDHAF2 Protein

Sign In for Pricing
View Details
Purified anti-human CD5
E16FHU005-500U 500 µg

Purified anti-human CD5

Sign In for Pricing
View Details