Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CBX7 protein

This Human CBX7 protein spans the amino acid sequence from region 1-251aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CBX7

UniProt

O95931

Expression Region

1-251aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1562342 Protein Vector (Rat) (pPM-C-HA)
39279026 500 ng

RGD1562342 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Phospho-Glucocorticoid Receptor (Ser211) Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-3168R-BF488-01 20 µL

Phospho-Glucocorticoid Receptor (Ser211) Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Phospho-Glucocorticoid Receptor (Ser211) Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-3168R-BF488-02 100 µL

Phospho-Glucocorticoid Receptor (Ser211) Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
2- (Trifluoromethyl) pyrazolo[1,5-α]pyrazin-4-ol
CKB40282-01 50 mg

2- (Trifluoromethyl) pyrazolo[1,5-α]pyrazin-4-ol

Sign In for Pricing
View Details
2- (Trifluoromethyl) pyrazolo[1,5-α]pyrazin-4-ol
CKB40282-02 0.5 g

2- (Trifluoromethyl) pyrazolo[1,5-α]pyrazin-4-ol

Sign In for Pricing
View Details
CGKII (D-3) Alexa Fluor® 647
sc-393126 AF647 200 µg/mL

CGKII (D-3) Alexa Fluor® 647

Sign In for Pricing
View Details