Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dog Caveolin 1 protein

This Dog Caveolin 1 protein spans the amino acid sequence from region 1-178a. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BSCL3 protein; CAV 1 protein; CAV protein; CAV1 protein; Caveolin-1 protein; Caveolin1 protein; cell growth-inhibiting protein 32 protein; CGL3 protein; LCCNS protein

UniProt

P33724

Expression Region

1-178a

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMAEEMSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPFFEAVGKIFSNIRINMQKET

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRF1 (NRF1/2609), 1mg/mL
BNUM2609-50 1x 50 µL

NRF1 (NRF1/2609), 1mg/mL

Sign In for Pricing
View Details
CCKBR Human Gene Knockout Kit (CRISPR)
KN400676 1 Kit

CCKBR Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HHLA1 Human Gene Knockout Kit (CRISPR)
KN427170 1 Kit

HHLA1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ANKRD63 (NM_001190479) Human Over-expression Lysate
LC434196 20 µg

ANKRD63 (NM_001190479) Human Over-expression Lysate

Sign In for Pricing
View Details
Human SLCO6A1 activation kit by CRISPRa
GA115199 1 Kit

Human SLCO6A1 activation kit by CRISPRa

Sign In for Pricing
View Details
Cytokeratin 17 (KRT17) Rabbit Polyclonal Antibody
AP06198PU-N 100 µg

Cytokeratin 17 (KRT17) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details