Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dog Caveolin 1 protein

This Dog Caveolin 1 protein spans the amino acid sequence from region 1-178a. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BSCL3 protein; CAV 1 protein; CAV protein; CAV1 protein; Caveolin-1 protein; Caveolin1 protein; cell growth-inhibiting protein 32 protein; CGL3 protein; LCCNS protein

UniProt

P33724

Expression Region

1-178a

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMAEEMSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPFFEAVGKIFSNIRINMQKET

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELP4 Polyclonal Antibody
E-AB-17905-01 20 µL

ELP4 Polyclonal Antibody

Sign In for Pricing
View Details
ELP4 Polyclonal Antibody
E-AB-17905-02 60 µL

ELP4 Polyclonal Antibody

Sign In for Pricing
View Details
ELP4 Polyclonal Antibody
E-AB-17905-03 120 µL

ELP4 Polyclonal Antibody

Sign In for Pricing
View Details
ELP4 Polyclonal Antibody
E-AB-17905-04 200 µL

ELP4 Polyclonal Antibody

Sign In for Pricing
View Details
Thiazole Green, 10, 000X in DMSO
#40086-1mL 1x 1 mL

Thiazole Green, 10, 000X in DMSO

Sign In for Pricing
View Details
NTAQ1 (NM_001283027) Human Tagged ORF Clone
RG235953 10 µg

NTAQ1 (NM_001283027) Human Tagged ORF Clone

Sign In for Pricing
View Details