Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human EIF4EBP3 protein

This Human EIF4EBP3 protein spans the amino acid sequence from region 1-100aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EIF4EBP3

UniProt

O60516

Expression Region

1-100aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-100aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEMDI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NR2F1 Antibody (HRP)
orb515732-01 50 µg

NR2F1 Antibody (HRP)

Sign In for Pricing
View Details
NR2F1 Antibody (HRP)
orb515732-02 100 µg

NR2F1 Antibody (HRP)

Sign In for Pricing
View Details
Rabbit Anti-Goat IgG (H+L) Secondary Antibody (AMCA)
orb633257-01 100 µL

Rabbit Anti-Goat IgG (H+L) Secondary Antibody (AMCA)

Sign In for Pricing
View Details
Rabbit Anti-Goat IgG (H+L) Secondary Antibody (AMCA)
orb633257-02 500 μL

Rabbit Anti-Goat IgG (H+L) Secondary Antibody (AMCA)

Sign In for Pricing
View Details
Tropomyosin Rabbit Polyclonal Antibody (APC)
orb1009242 100 µL

Tropomyosin Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Artocarpus integrifolia (Jacalin, Jackfruit)
A3590-12 25 mg

Artocarpus integrifolia (Jacalin, Jackfruit)

Sign In for Pricing
View Details