Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DUSP14 protein

This Human DUSP14 protein spans the amino acid sequence from region 1-198aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DUSP14

UniProt

O95147

Expression Region

1-198aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-198aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYWGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Caenorhabditis elegans Protein jagunal homolog (K05C4.2), partial
MBS7102596 Inquire

Recombinant Caenorhabditis elegans Protein jagunal homolog (K05C4.2), partial

Sign In for Pricing
View Details
Plant NF-kappa-B Inhibitor Beta (NFKBIB) ELISA Kit
MBS9378597 Inquire

Plant NF-kappa-B Inhibitor Beta (NFKBIB) ELISA Kit

Sign In for Pricing
View Details
TATA Box Binding Protein Associated Factor 11 (TAF11) Antibody
abx242039-01 50 µL

TATA Box Binding Protein Associated Factor 11 (TAF11) Antibody

Sign In for Pricing
View Details
TATA Box Binding Protein Associated Factor 11 (TAF11) Antibody
abx242039-02 100 µL

TATA Box Binding Protein Associated Factor 11 (TAF11) Antibody

Sign In for Pricing
View Details
Anti-CD44 Mouse mAb
E2200840 100 µL

Anti-CD44 Mouse mAb

Sign In for Pricing
View Details
Recombinant Monoclonal Anti-PD-1 Antibody, Mouse (2F3)
HGS-S238-100ul 100 µL

Recombinant Monoclonal Anti-PD-1 Antibody, Mouse (2F3)

Sign In for Pricing
View Details