Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CA1 protein

This Human CA1 protein spans the amino acid sequence from region 2-261aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CA1

UniProt

P00915

Expression Region

2-261aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C12orf52 Protein Vector (Human) (pPB-His-GST)
PV328619 500 ng

C12orf52 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
hsa-miR-3618 miRNA Antagomir
MBS8317050-01 10 nmol

hsa-miR-3618 miRNA Antagomir

Sign In for Pricing
View Details
hsa-miR-3618 miRNA Antagomir
MBS8317050-02 20 nmol

hsa-miR-3618 miRNA Antagomir

Sign In for Pricing
View Details
hsa-miR-3618 miRNA Antagomir
MBS8317050-03 5x 20 nmol

hsa-miR-3618 miRNA Antagomir

Sign In for Pricing
View Details
Gm608 Protein Vector (Mouse) (pPM-C-HA)
PV184596 500 ng

Gm608 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
P2ry1 3'UTR GFP Stable Cell Line
TU265728 1.0 mL

P2ry1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details