Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CA1 protein

This Human CA1 protein spans the amino acid sequence from region 2-261aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CA1

UniProt

P00915

Expression Region

2-261aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-4519 agomir
HY-R01138A-01 5 nmol

Hsa-miR-4519 agomir

Sign In for Pricing
View Details
Hsa-miR-4519 agomir
HY-R01138A-02 20 nmol

Hsa-miR-4519 agomir

Sign In for Pricing
View Details
Balance, Topload, TS, 2100g x 0.01g
GBT-2102C-CT 1 Each

Balance, Topload, TS, 2100g x 0.01g

Sign In for Pricing
View Details
NPY5R Protein Vector (Human) (pPB-C-His)
PV104978 500 ng

NPY5R Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Anti-Pirh2 (Mouse, Monoclonal)
A119044 100 µL

Anti-Pirh2 (Mouse, Monoclonal)

Sign In for Pricing
View Details
Recombinant Trafficking Protein, Kinesin Binding 2 (TRAK2)
MBS2123474-01 0.01 mg

Recombinant Trafficking Protein, Kinesin Binding 2 (TRAK2)

Sign In for Pricing
View Details