Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BOLA1 protein

This Human BOLA1 protein spans the amino acid sequence from region 1-137aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BOLA1

UniProt

Q9Y3E2

Expression Region

1-137aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLSGRLVLGLVSMAGRVCLCQGSAGSGAIGPVEAAIRTKLEEALSPEVLELRNESGGHAVPPGSETHFRVAVVSSRFEGLSPLQRHRLVHAALAEELGGPVHALAIQARTPAQWRENSQLDTSPPCLGGNKKTLGTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-5087 mimic
HY-R01522-01 5 nmol

Hsa-miR-5087 mimic

Sign In for Pricing
View Details
Hsa-miR-5087 mimic
HY-R01522-02 20 nmol

Hsa-miR-5087 mimic

Sign In for Pricing
View Details
MEIS3, ID (MEIS3, MRG2, Homeobox protein Meis3, Meis1-related protein 2) (FITC)
MBS6320180-01 0.2 mL

MEIS3, ID (MEIS3, MRG2, Homeobox protein Meis3, Meis1-related protein 2) (FITC)

Sign In for Pricing
View Details
MEIS3, ID (MEIS3, MRG2, Homeobox protein Meis3, Meis1-related protein 2) (FITC)
MBS6320180-02 5x 0.2 mL

MEIS3, ID (MEIS3, MRG2, Homeobox protein Meis3, Meis1-related protein 2) (FITC)

Sign In for Pricing
View Details
MHC II Antibody
orb2806674 0.2 mg

MHC II Antibody

Sign In for Pricing
View Details
CFC1 Rabbit Polyclonal Antibody (BF680)
orb2520461 100 µL

CFC1 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details