Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BOLA1 protein

This Human BOLA1 protein spans the amino acid sequence from region 1-137aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BOLA1

UniProt

Q9Y3E2

Expression Region

1-137aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLSGRLVLGLVSMAGRVCLCQGSAGSGAIGPVEAAIRTKLEEALSPEVLELRNESGGHAVPPGSETHFRVAVVSSRFEGLSPLQRHRLVHAALAEELGGPVHALAIQARTPAQWRENSQLDTSPPCLGGNKKTLGTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N,N'-Dibenzylacetimidamide Hydrochloride
TRC-B335800-500MG 500 mg

N,N'-Dibenzylacetimidamide Hydrochloride

Sign In for Pricing
View Details
Human IL-12p70 ELISA Kit (96-well)
EA100038 96 Well

Human IL-12p70 ELISA Kit (96-well)

Sign In for Pricing
View Details
gamma Tubulin (TUBG1) (434-449) Mouse Monoclonal Antibody [Clone ID: TU-32]
AM03180PU-N 100 µg

gamma Tubulin (TUBG1) (434-449) Mouse Monoclonal Antibody [Clone ID: TU-32]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD40 Antibody[G28.5]
E-AB-F1214H-01 20 Tests

PE/Cyanine7 Anti-Human CD40 Antibody[G28.5]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD40 Antibody[G28.5]
E-AB-F1214H-02 100 Tests

PE/Cyanine7 Anti-Human CD40 Antibody[G28.5]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD40 Antibody[G28.5]
E-AB-F1214H-03 2x 100 Tests

PE/Cyanine7 Anti-Human CD40 Antibody[G28.5]

Sign In for Pricing
View Details