Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BOLA1 protein

This Human BOLA1 protein spans the amino acid sequence from region 1-137aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BOLA1

UniProt

Q9Y3E2

Expression Region

1-137aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLSGRLVLGLVSMAGRVCLCQGSAGSGAIGPVEAAIRTKLEEALSPEVLELRNESGGHAVPPGSETHFRVAVVSSRFEGLSPLQRHRLVHAALAEELGGPVHALAIQARTPAQWRENSQLDTSPPCLGGNKKTLGTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC18 / CD146 / MCAM (Melanoma Cell Adhesion Molecule) (rMUC18/1130), 1mg/mL
BNUM2302-50 1x 50 µL

MUC18 / CD146 / MCAM (Melanoma Cell Adhesion Molecule) (rMUC18/1130), 1mg/mL

Sign In for Pricing
View Details
Recombinant HLA-A Antibody
RC-4566-01 50 μL

Recombinant HLA-A Antibody

Sign In for Pricing
View Details
Recombinant HLA-A Antibody
RC-4566-02 100 µL

Recombinant HLA-A Antibody

Sign In for Pricing
View Details
Recombinant HLA-A Antibody
RC-4566-03 1 mL

Recombinant HLA-A Antibody

Sign In for Pricing
View Details
Tryptophan Hydroxylase (Ab-58) Antibody
8B1011-AAT 50 µg

Tryptophan Hydroxylase (Ab-58) Antibody

Sign In for Pricing
View Details
Recombinant Human INPP5A Protein (His Tag)
PKSH033170-01 10 µg

Recombinant Human INPP5A Protein (His Tag)

Sign In for Pricing
View Details