Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dog BCHE protein

This Dog BCHE protein spans the amino acid sequence from region 1-141aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BCHE

UniProt

P32750

Expression Region

1-141aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NTDQSFPGFPGSEMWNPNTDLSEDCLYLNVWIPTPKPKNATVMIWIYGGGFQTGTSSLPVYDGKFLARVERVIVVSVNYRVGALGFLALPGNPEAPGNLGLFDQQLALQWVQKNIAAFGGNPKSVTLFGESAGAGSVGLHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAP2C, NT (RAP2C, Ras-related protein Rap-2c) (Azide free) (HRP) discontinued
040832-HRP 200 µL

RAP2C, NT (RAP2C, Ras-related protein Rap-2c) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Recombinant Human Siglec-9 (C-6His)
CW60-500ug 500 µg

Recombinant Human Siglec-9 (C-6His)

Sign In for Pricing
View Details
Benzyl 2,3-O-isopropylidene-6-O-trityl-a-D-mannofuranose
292723-01 25 mg

Benzyl 2,3-O-isopropylidene-6-O-trityl-a-D-mannofuranose

Sign In for Pricing
View Details
Benzyl 2,3-O-isopropylidene-6-O-trityl-a-D-mannofuranose
292723-02 50 mg

Benzyl 2,3-O-isopropylidene-6-O-trityl-a-D-mannofuranose

Sign In for Pricing
View Details
Benzyl 2,3-O-isopropylidene-6-O-trityl-a-D-mannofuranose
292723-03 100 mg

Benzyl 2,3-O-isopropylidene-6-O-trityl-a-D-mannofuranose

Sign In for Pricing
View Details
N- (1,1-Dimethylethyl) benzenemethanamine
456781-01 5 g

N- (1,1-Dimethylethyl) benzenemethanamine

Sign In for Pricing
View Details