Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dog BCHE protein

This Dog BCHE protein spans the amino acid sequence from region 1-141aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BCHE

UniProt

P32750

Expression Region

1-141aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NTDQSFPGFPGSEMWNPNTDLSEDCLYLNVWIPTPKPKNATVMIWIYGGGFQTGTSSLPVYDGKFLARVERVIVVSVNYRVGALGFLALPGNPEAPGNLGLFDQQLALQWVQKNIAAFGGNPKSVTLFGESAGAGSVGLHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Procollagen C peptidase ELISA kit
GTR10430570 96 Well

Human Procollagen C peptidase ELISA kit

Sign In for Pricing
View Details
HA Tag Immunoprecipitation Kit
C0118 40 Tests

HA Tag Immunoprecipitation Kit

Sign In for Pricing
View Details
LG100268
MBS5756171 Inquire

LG100268

Sign In for Pricing
View Details
TPM2 Polyclonal Antibody, FITC Conjugated
A53131-100 100 µL

TPM2 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Mouse DC-SIGN/CD209 Alexa Fluor 350 Antibody (Clone MMD3)
FAB83451U-100UG 100 µg

Mouse DC-SIGN/CD209 Alexa Fluor 350 Antibody (Clone MMD3)

Sign In for Pricing
View Details
Human TRAF7 Recombinant Protein (N-His)
HD350012-01 50 µg

Human TRAF7 Recombinant Protein (N-His)

Sign In for Pricing
View Details