Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dog BCHE protein

This Dog BCHE protein spans the amino acid sequence from region 1-141aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BCHE

UniProt

P32750

Expression Region

1-141aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NTDQSFPGFPGSEMWNPNTDLSEDCLYLNVWIPTPKPKNATVMIWIYGGGFQTGTSSLPVYDGKFLARVERVIVVSVNYRVGALGFLALPGNPEAPGNLGLFDQQLALQWVQKNIAAFGGNPKSVTLFGESAGAGSVGLHL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fcer2a Protein Vector (Mouse) (pPB-C-His)
PV178942 500 ng

Fcer2a Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Lentiviral mouse Cldn14 shRNA (UAS) - Lentiviral mouse Cldn14 shRNA (UAS, iRFP) (25)
GTR15180734 1 Vial

Lentiviral mouse Cldn14 shRNA (UAS) - Lentiviral mouse Cldn14 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Human Cytokeratin 9 (CK9) ELISA Kit
EKN46593 96 Tests

Human Cytokeratin 9 (CK9) ELISA Kit

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Interleukin 1 Beta (IL1b)
MBS2044231-01 0.1 mL

HRP-Linked Polyclonal Antibody to Interleukin 1 Beta (IL1b)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Interleukin 1 Beta (IL1b)
MBS2044231-02 0.2 mL

HRP-Linked Polyclonal Antibody to Interleukin 1 Beta (IL1b)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Interleukin 1 Beta (IL1b)
MBS2044231-03 0.5 mL

HRP-Linked Polyclonal Antibody to Interleukin 1 Beta (IL1b)

Sign In for Pricing
View Details