Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ATP4B protein

This Human ATP4B protein spans the amino acid sequence from region 58-291. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ATP4B

UniProt

P51164

Expression Region

58-291

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CLYVLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CASP4 Rabbit Polyclonal Antibody (PE-Cy5)
orb890274 100 µL

CASP4 Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
Manganese Foil 1 mm, casted, 99.9%
GX0468-25x25mm 25x 25 mm

Manganese Foil 1 mm, casted, 99.9%

Sign In for Pricing
View Details
Phospho-DDR1 (Tyr796) Blocking Peptide
MBS9619378-01 1 mg

Phospho-DDR1 (Tyr796) Blocking Peptide

Sign In for Pricing
View Details
Phospho-DDR1 (Tyr796) Blocking Peptide
MBS9619378-02 5x 1 mg

Phospho-DDR1 (Tyr796) Blocking Peptide

Sign In for Pricing
View Details
Canine Thyroid Stimulating Hormone (TSH) ELISA Kit
RD-TSH-c-01 96 Tests

Canine Thyroid Stimulating Hormone (TSH) ELISA Kit

Sign In for Pricing
View Details
Canine Thyroid Stimulating Hormone (TSH) ELISA Kit
RD-TSH-c-02 48 Tests

Canine Thyroid Stimulating Hormone (TSH) ELISA Kit

Sign In for Pricing
View Details