Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ATP4B protein

This Human ATP4B protein spans the amino acid sequence from region 58-291. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ATP4B

UniProt

P51164

Expression Region

58-291

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CLYVLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP-Binding Cassette Sub-Family E Member 1 (ABCE1) Antibody
abx455635-01 50 µg

ATP-Binding Cassette Sub-Family E Member 1 (ABCE1) Antibody

Sign In for Pricing
View Details
ATP-Binding Cassette Sub-Family E Member 1 (ABCE1) Antibody
abx455635-02 100 µg

ATP-Binding Cassette Sub-Family E Member 1 (ABCE1) Antibody

Sign In for Pricing
View Details
NF-κB p105 (Cleaved-Thr434) rabbit pAb
RA27764-01 50 µL

NF-κB p105 (Cleaved-Thr434) rabbit pAb

Sign In for Pricing
View Details
NF-κB p105 (Cleaved-Thr434) rabbit pAb
RA27764-02 100 µL

NF-κB p105 (Cleaved-Thr434) rabbit pAb

Sign In for Pricing
View Details
Lentiviral human LRRC28 shRNA (UAS) - Lentiviral human LRRC28 shRNA (UAS, iRFP) (25)
GTR15324017 1 Vial

Lentiviral human LRRC28 shRNA (UAS) - Lentiviral human LRRC28 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Anti-CD21
DB-213-0.1 100 μl

Anti-CD21

Sign In for Pricing
View Details