Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human APOC4 protein

This Human APOC4 protein spans the amino acid sequence from region 27-127aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

APOC4

UniProt

P55056

Expression Region

27-127aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hnf1b sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3774408 1.0 µg DNA

Hnf1b sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Canine Transforming Growth Factor 1 ELISA Kit
MBS735238-01 48 Well

Canine Transforming Growth Factor 1 ELISA Kit

Sign In for Pricing
View Details
Canine Transforming Growth Factor 1 ELISA Kit
MBS735238-02 96 Well

Canine Transforming Growth Factor 1 ELISA Kit

Sign In for Pricing
View Details
Canine Transforming Growth Factor 1 ELISA Kit
MBS735238-03 5x 96 Well

Canine Transforming Growth Factor 1 ELISA Kit

Sign In for Pricing
View Details
Canine Transforming Growth Factor 1 ELISA Kit
MBS735238-04 10x 96 Well

Canine Transforming Growth Factor 1 ELISA Kit

Sign In for Pricing
View Details
Phusion High-Fidelity PCR Master Mix with HF Buffer
NEB M0531S 100 Reactions

Phusion High-Fidelity PCR Master Mix with HF Buffer

Sign In for Pricing
View Details