Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human APOC4 protein

This Human APOC4 protein spans the amino acid sequence from region 27-127aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

APOC4

UniProt

P55056

Expression Region

27-127aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anserine CBV IgD ELISA Kit
EAC0065 96 Tests

Anserine CBV IgD ELISA Kit

Sign In for Pricing
View Details
Chicken sIgA (Secretory Immunoglobulin A) ELISA Kit
ELK11360-01 48 Tests

Chicken sIgA (Secretory Immunoglobulin A) ELISA Kit

Sign In for Pricing
View Details
Chicken sIgA (Secretory Immunoglobulin A) ELISA Kit
ELK11360-02 96 Tests

Chicken sIgA (Secretory Immunoglobulin A) ELISA Kit

Sign In for Pricing
View Details
Chicken sIgA (Secretory Immunoglobulin A) ELISA Kit
ELK11360-03 5x 96 Tests

Chicken sIgA (Secretory Immunoglobulin A) ELISA Kit

Sign In for Pricing
View Details
WFDC1 Antibody
orb1269578 400 μl

WFDC1 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal CARD10 Antibody [CoraFluor 1]
NBP1-76676CL1 0.1 mL

Rabbit Polyclonal CARD10 Antibody [CoraFluor 1]

Sign In for Pricing
View Details