Human Collagen IV protein
This Human Collagen IV protein spans the amino acid sequence from region 1445-1669aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Arresten, BSVD, CO4A1_HUMAN, COL4A1, COL4A1 NC1 domain, COL4A2, COL4A3, COL4A4, COL4A5, collagen alpha-1 (IV) chain, Collagen IV Alpha 1 Polypeptide, Collagen IV Alpha 2 Polypeptide, Collagen Of Basement Membrane Alpha 1 Chain, Collagen Of Basement Membrane Alpha 2 Chain, Collagen Type IV Alpha 1, collagen type IV alpha 1 chain, Collagen Type IV Alpha 2, Collagen Type IV Alpha 3, Collagen Type IV Alpha 4, Collagen Type IV Alpha 5, RATOR
UniProt
P02462
Expression Region
1445-1669aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Musculoskeletal & Connective Tissue Research
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
40.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Arresten of His-SUMO-tag and expression region is 1445-1669aa
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
GFLVTRHSQTIDDPQCPSGTKILYHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPITGENIRPFISRCAVCEAPAMVMAVHSQTIQIPPCPSGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNYYANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog