Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Collagen IV protein

This Human Collagen IV protein spans the amino acid sequence from region 1445-1669aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Arresten, BSVD, CO4A1_HUMAN, COL4A1, COL4A1 NC1 domain, COL4A2, COL4A3, COL4A4, COL4A5, collagen alpha-1 (IV) chain, Collagen IV Alpha 1 Polypeptide, Collagen IV Alpha 2 Polypeptide, Collagen Of Basement Membrane Alpha 1 Chain, Collagen Of Basement Membrane Alpha 2 Chain, Collagen Type IV Alpha 1, collagen type IV alpha 1 chain, Collagen Type IV Alpha 2, Collagen Type IV Alpha 3, Collagen Type IV Alpha 4, Collagen Type IV Alpha 5, RATOR

UniProt

P02462

Expression Region

1445-1669aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Arresten of His-SUMO-tag and expression region is 1445-1669aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GFLVTRHSQTIDDPQCPSGTKILYHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPITGENIRPFISRCAVCEAPAMVMAVHSQTIQIPPCPSGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNYYANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAPSIN A Antibody [P4L17]
C21982-100uL*2 2x 100μL

NAPSIN A Antibody [P4L17]

Sign In for Pricing
View Details
Rat Ubiquitin-Conjugating Enzyme E2 D2 (UBE2D2) ELISA Kit
MBS9946296-01 48 Well

Rat Ubiquitin-Conjugating Enzyme E2 D2 (UBE2D2) ELISA Kit

Sign In for Pricing
View Details
Rat Ubiquitin-Conjugating Enzyme E2 D2 (UBE2D2) ELISA Kit
MBS9946296-02 96 Well

Rat Ubiquitin-Conjugating Enzyme E2 D2 (UBE2D2) ELISA Kit

Sign In for Pricing
View Details
Rat Ubiquitin-Conjugating Enzyme E2 D2 (UBE2D2) ELISA Kit
MBS9946296-03 5x 96 Well

Rat Ubiquitin-Conjugating Enzyme E2 D2 (UBE2D2) ELISA Kit

Sign In for Pricing
View Details
Rat Ubiquitin-Conjugating Enzyme E2 D2 (UBE2D2) ELISA Kit
MBS9946296-04 10x 96 Well

Rat Ubiquitin-Conjugating Enzyme E2 D2 (UBE2D2) ELISA Kit

Sign In for Pricing
View Details
CLIC1 CRISPR Activation Plasmid (m2)
sc-431107-ACT-2 20 µg

CLIC1 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details