Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Apoc3 protein

This Rat Apoc3 protein spans the amino acid sequence from region 21-101aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Apoc3

UniProt

P06759

Expression Region

21-101aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DEGEGSLLLGSMQGYMEQASKTVQDALSSMQESDIAVVASRGWMDNRFKSLKGYWSKFTDKFTGLWESGPEDQLTTPTLEP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant human proBNP protein, N-His (HEK293), APC Conjugated
bs-43095P-APC-01 20 µg

Recombinant human proBNP protein, N-His (HEK293), APC Conjugated

Sign In for Pricing
View Details
Recombinant human proBNP protein, N-His (HEK293), APC Conjugated
bs-43095P-APC-02 100 µg

Recombinant human proBNP protein, N-His (HEK293), APC Conjugated

Sign In for Pricing
View Details
Recombinant human proBNP protein, N-His (HEK293), APC Conjugated
bs-43095P-APC-03 500 µg

Recombinant human proBNP protein, N-His (HEK293), APC Conjugated

Sign In for Pricing
View Details
Bafilomycin A1
1829-250 250 µg

Bafilomycin A1

Sign In for Pricing
View Details
SRA1 AAV Vector (Rat) (CMV)
45436106 1 µg

SRA1 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
RPL9P10 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV775977 1.0 µg DNA

RPL9P10 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details