Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Apoc3 protein

This Rat Apoc3 protein spans the amino acid sequence from region 21-101aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Apoc3

UniProt

P06759

Expression Region

21-101aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DEGEGSLLLGSMQGYMEQASKTVQDALSSMQESDIAVVASRGWMDNRFKSLKGYWSKFTDKFTGLWESGPEDQLTTPTLEP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Xpress™ Human SYNPR Over-expressing Stable Cell Line
ABC-X3046 1 Vial

Xpress™ Human SYNPR Over-expressing Stable Cell Line

Sign In for Pricing
View Details
Tert-Butyl Cyclohexyl (2-hydroxyethyl) carbamate
OR1003635-01 50 mg

Tert-Butyl Cyclohexyl (2-hydroxyethyl) carbamate

Sign In for Pricing
View Details
Tert-Butyl Cyclohexyl (2-hydroxyethyl) carbamate
OR1003635-02 100 mg

Tert-Butyl Cyclohexyl (2-hydroxyethyl) carbamate

Sign In for Pricing
View Details
Tert-Butyl Cyclohexyl (2-hydroxyethyl) carbamate
OR1003635-03 250 mg

Tert-Butyl Cyclohexyl (2-hydroxyethyl) carbamate

Sign In for Pricing
View Details
Tert-Butyl Cyclohexyl (2-hydroxyethyl) carbamate
OR1003635-04 500 mg

Tert-Butyl Cyclohexyl (2-hydroxyethyl) carbamate

Sign In for Pricing
View Details
Tert-Butyl Cyclohexyl (2-hydroxyethyl) carbamate
OR1003635-05 1 g

Tert-Butyl Cyclohexyl (2-hydroxyethyl) carbamate

Sign In for Pricing
View Details