Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Apoc3 protein

This Rat Apoc3 protein spans the amino acid sequence from region 21-101aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Apoc3

UniProt

P06759

Expression Region

21-101aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DEGEGSLLLGSMQGYMEQASKTVQDALSSMQESDIAVVASRGWMDNRFKSLKGYWSKFTDKFTGLWESGPEDQLTTPTLEP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ZNF521 Antibody [Allophycocyanin]
NBP1-91270APC 0.1 mL

Rabbit Polyclonal ZNF521 Antibody [Allophycocyanin]

Sign In for Pricing
View Details
mPEG-PLGA (1K), 5K
MF001082-5K Inquire

mPEG-PLGA (1K), 5K

Sign In for Pricing
View Details
Bik Rabbit Polyclonal Antibody (PE)
orb2619357 100 µg

Bik Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Obp2a Mouse Gene Knockout Kit (CRISPR)
KN511423 1 Kit

Obp2a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rabbit Polyclonal CCDC91 Antibody
NBP1-84084 0.1 mL

Rabbit Polyclonal CCDC91 Antibody

Sign In for Pricing
View Details
Monoclonal Antibody Against Human HSP90 alpha Monoclonal Antibody [K41233]
MC-1053 1 Each

Monoclonal Antibody Against Human HSP90 alpha Monoclonal Antibody [K41233]

Sign In for Pricing
View Details