Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CDK5 protein

This Human CDK5 protein spans the amino acid sequence from region 1-292aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CDK5

UniProt

Q00535

Expression Region

1-292aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-292aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hepatitis Be Antigen Antibody
GWB-7C4D47 1 mg

Hepatitis Be Antigen Antibody

Sign In for Pricing
View Details
Fign (NM_001106484) Rat Tagged ORF Clone Lentiviral Particle
RR201298L3V 200 µL

Fign (NM_001106484) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Delta-1-Pyrroline-5-Carboxylate Synthase (ALDH18A1) Antibody
abx125513-01 60 µL

Delta-1-Pyrroline-5-Carboxylate Synthase (ALDH18A1) Antibody

Sign In for Pricing
View Details
Delta-1-Pyrroline-5-Carboxylate Synthase (ALDH18A1) Antibody
abx125513-02 120 µL

Delta-1-Pyrroline-5-Carboxylate Synthase (ALDH18A1) Antibody

Sign In for Pricing
View Details
Delta-1-Pyrroline-5-Carboxylate Synthase (ALDH18A1) Antibody
abx125513-03 200 µL

Delta-1-Pyrroline-5-Carboxylate Synthase (ALDH18A1) Antibody

Sign In for Pricing
View Details
CTSC AAV Vector (Mouse) (CMV)
17095104 1 µg

CTSC AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details