Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CDK5 protein

This Human CDK5 protein spans the amino acid sequence from region 1-292aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CDK5

UniProt

Q00535

Expression Region

1-292aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-292aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDAC7, CT (HDAC7, HDAC7A, Histone deacetylase 7, Histone deacetylase 7A) (PE)
MBS6305932-01 0.2 mL

HDAC7, CT (HDAC7, HDAC7A, Histone deacetylase 7, Histone deacetylase 7A) (PE)

Sign In for Pricing
View Details
HDAC7, CT (HDAC7, HDAC7A, Histone deacetylase 7, Histone deacetylase 7A) (PE)
MBS6305932-02 5x 0.2 mL

HDAC7, CT (HDAC7, HDAC7A, Histone deacetylase 7, Histone deacetylase 7A) (PE)

Sign In for Pricing
View Details
Human CCL23 (C-C motif chemokine 23) ELISA Kit
E39EH0063 96 Tests

Human CCL23 (C-C motif chemokine 23) ELISA Kit

Sign In for Pricing
View Details
CYP1B1-IN-4
BA7281-50 50 mg

CYP1B1-IN-4

Sign In for Pricing
View Details
CNTNAP2, ID (Contactin-associated Protein-like 2, Cell Recognition Molecule Caspr2, KIAA0868, CASPR2) (MaxLight 750) discontinued
C7865-20A-ML750 100 µL

CNTNAP2, ID (Contactin-associated Protein-like 2, Cell Recognition Molecule Caspr2, KIAA0868, CASPR2) (MaxLight 750) discontinued

Sign In for Pricing
View Details
POLK, ID (POLK, DINB1, DNA polymerase kappa, DINB protein) (AP)
MBS6335620-01 0.2 mL

POLK, ID (POLK, DINB1, DNA polymerase kappa, DINB protein) (AP)

Sign In for Pricing
View Details