Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CAST protein

This Human CAST protein spans the amino acid sequence from region 1-667aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CAST

UniProt

P20810

Expression Region

1-667aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

75.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of the full length of 1-708aa of His-tag and expression region is 1-667aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNPTETKAVKTEPEKKSQSTKPKSLPKQASDTGSNDAHNKKAVSRSAEQQPSEKSTEPKTKPQDMISAGGESVAGITAISGKPGDKKKEKKSLTPAVPVESKPDKPSGKSGMDAALDDLIDTLGGPEETEEENTTYTGPEVSDPMSSTYIEELGKREVTIPPKYRELLAKKEGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGKKTEKEESTEVLKAQSAGTVRSAAPPQEKKRKVEKDTMSDQALEALSASLGTRQAEPELDLRSIKEVDEAKAKEEKLEKCGEDDETIPSEYRLKPATDKDGKPLLPEPEEKPKPRSESELIDELSEDFDRSECKEKPSKPTEKTEESKAAAPAPVSEAVCRTSMCSIQSAPPEPATLKGTVPDDAVEALADSLGKKEADPEDGKPVMDKVKEKAKEEDREKLGEKEETIPPDYRLEEVKDKDGKPLLPKESKEQLPPMSEDFLLDALSEDFSGPQNASSLKFEDAKLAAAISEVVSQTPASTTQAGAPPRDTSQSDKDLDDALDKLSDSLGQRQPDPDENKPMEDKVKEKAKAEHRDKLGERDDTIPPEYRHLLDDNGQDKPVKPPTKKSEDSKKPADDQDPIDALSGDLDSCPSTTETSQNTAKDKCKKAASSSKAPKNGGKAKDSAKTTEETSKPKDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAP Protein Vector (Rat) (pPM-C-HA)
PV267796 500 ng

FAP Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
ANKHD1 Knockout SK-HEP-1 Polyclonal Cells
ARG32163 1 Million

ANKHD1 Knockout SK-HEP-1 Polyclonal Cells

Sign In for Pricing
View Details
HPV16 L1/Major capsid protein L1 Human Monoclonal Antibody
orb2961057-01 50 µg

HPV16 L1/Major capsid protein L1 Human Monoclonal Antibody

Sign In for Pricing
View Details
HPV16 L1/Major capsid protein L1 Human Monoclonal Antibody
orb2961057-02 100 µg

HPV16 L1/Major capsid protein L1 Human Monoclonal Antibody

Sign In for Pricing
View Details
HPV16 L1/Major capsid protein L1 Human Monoclonal Antibody
orb2961057-03 1 mg

HPV16 L1/Major capsid protein L1 Human Monoclonal Antibody

Sign In for Pricing
View Details
RNU6-66 Protein Vector (Human) (pPM-C-HA)
PV118936 500 ng

RNU6-66 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details