Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine Apolipoprotein AI protein

This Bovine Apolipoprotein AI protein spans the amino acid sequence from region 25-265aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

APOA1 protein, Apolipoprotein A I protein, Apolipoprotein A1 protein, Apo AI protein, ApoA I protein, APOA1 protein, APOA1/APOC3 fusion gene protein, Apo A1 protein, Apo A1 protein, Apolipoprotein A I precursor protein, Apolipoprotein AI protein, Apolipoprotein of high density lipoprotein protein, ApolipoproteinAI protein, Brp14 protein, Ltw1 protein, Lvtw1 protein, Sep1 protein, Sep2 protein

UniProt

P15497

Expression Region

25-265aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DDPQSSWDRVKDFATVYVEAIKDSGRDYVAQFEASALGKQLNLKLLDNWDTLASTLSKVREQLGPVTQEFWDNLEKETASLRQEMHKDLEEVKQKVQPYLDEFQKKWHEEVEIYRQKVAPLGEEFREGARQKVQELQDKLSPLAQELRDRARAHVETLRQQLAPYSDDLRQRLTARLEALKEGGGSLAEYHAKASEQLKALGEKAKPVLEDLRQGLLPVLESLKVSILAAIDEASKKLNAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CA9 Conjugated Antibody
MBS9446131-01 0.1 mL (Biotin)

CA9 Conjugated Antibody

Sign In for Pricing
View Details
CA9 Conjugated Antibody
MBS9446131-02 0.1 mL (AF350)

CA9 Conjugated Antibody

Sign In for Pricing
View Details
CA9 Conjugated Antibody
MBS9446131-03 0.1 mL (AF405)

CA9 Conjugated Antibody

Sign In for Pricing
View Details
CA9 Conjugated Antibody
MBS9446131-04 0.1 mL (AF488)

CA9 Conjugated Antibody

Sign In for Pricing
View Details
CA9 Conjugated Antibody
MBS9446131-05 0.1 mL (AF555)

CA9 Conjugated Antibody

Sign In for Pricing
View Details
CA9 Conjugated Antibody
MBS9446131-06 0.1 mL (AF594)

CA9 Conjugated Antibody

Sign In for Pricing
View Details