Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CASP2 protein

This Human CASP2 protein spans the amino acid sequence from region 2-452aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CASP2

UniProt

P42575

Expression Region

2-452aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

66.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 2-452aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AAPSAGSWSTFQHKELMAADRGRRILGVCGMHPHHQETLKKNRVVLAKQLLLSELLEHLLEKDIITLEMRELIQAKVGSFSQNVELLNLLPKRGPQAFDAFCEALRETKQGHLEDMLLTTLSGLQHVLPPLSCDYDLSLPFPVCESCPLYKKLRLSTDTVEHSLDNKDGPVCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRSGGDVDHSTLVTLFKLLGYDVHVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVEGAIYGVDGKLLQLQEVFQLFDNANCPSLQNKPKMFFIQACRGDETDRGVDQQDGKNHAGSPGCEESDAGKEKLPKMRLPTRSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVADMLVKVNALIKDREGYAPGTEFHRCKEMSEYCSTLCRHLYLFPGHPPT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC33 (NM_025055) Human Tagged Lenti ORF Clone
RC220049L4 10 µg

CCDC33 (NM_025055) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Mouse Matrix Metalloproteinase 11 (MMP11)
RPU42691-01 50 µg

Recombinant Mouse Matrix Metalloproteinase 11 (MMP11)

Sign In for Pricing
View Details
Recombinant Mouse Matrix Metalloproteinase 11 (MMP11)
RPU42691-02 100 µg

Recombinant Mouse Matrix Metalloproteinase 11 (MMP11)

Sign In for Pricing
View Details
Recombinant Mouse Matrix Metalloproteinase 11 (MMP11)
RPU42691-03 1 mg

Recombinant Mouse Matrix Metalloproteinase 11 (MMP11)

Sign In for Pricing
View Details
PARP10 Blocking Peptide
33R-2155 0.1 mg

PARP10 Blocking Peptide

Sign In for Pricing
View Details
Recombinant Human Transcriptional enhancer factor TEF-4 (TEAD2), partial
CSB-EP613597HU2-01 20 µg

Recombinant Human Transcriptional enhancer factor TEF-4 (TEAD2), partial

Sign In for Pricing
View Details