Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CASP2 protein

This Human CASP2 protein spans the amino acid sequence from region 2-452aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CASP2

UniProt

P42575

Expression Region

2-452aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

66.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 2-452aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AAPSAGSWSTFQHKELMAADRGRRILGVCGMHPHHQETLKKNRVVLAKQLLLSELLEHLLEKDIITLEMRELIQAKVGSFSQNVELLNLLPKRGPQAFDAFCEALRETKQGHLEDMLLTTLSGLQHVLPPLSCDYDLSLPFPVCESCPLYKKLRLSTDTVEHSLDNKDGPVCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRSGGDVDHSTLVTLFKLLGYDVHVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVEGAIYGVDGKLLQLQEVFQLFDNANCPSLQNKPKMFFIQACRGDETDRGVDQQDGKNHAGSPGCEESDAGKEKLPKMRLPTRSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVADMLVKVNALIKDREGYAPGTEFHRCKEMSEYCSTLCRHLYLFPGHPPT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFB4 Recombinant Protein (Human)
RP078021 100 µg

NDUFB4 Recombinant Protein (Human)

Sign In for Pricing
View Details
Sprouty 2 (SPRY2) Human siRNA Oligo Duplex (Locus ID 10253)
SR306939 1 Kit

Sprouty 2 (SPRY2) Human siRNA Oligo Duplex (Locus ID 10253)

Sign In for Pricing
View Details
Goat Protein Fantom (RPGRIP1L) ELISA Kit
MBS9397545 Inquire

Goat Protein Fantom (RPGRIP1L) ELISA Kit

Sign In for Pricing
View Details
Anti-SLC5A3 Antibody Picoband® HRP Conjugated
A08337-1-HRP 100 µg/Vial

Anti-SLC5A3 Antibody Picoband® HRP Conjugated

Sign In for Pricing
View Details
SLC25A26 Antibody
A59109-100UG 100 µg

SLC25A26 Antibody

Sign In for Pricing
View Details
AGAP8 (AGAP4) (NM_001291379) Human Tagged ORF Clone
RG238968 10 µg

AGAP8 (AGAP4) (NM_001291379) Human Tagged ORF Clone

Sign In for Pricing
View Details